PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P11820_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 139aa    MW: 15867.2 Da    PI: 9.4729
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P11820_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.32e-281059251
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           r en + rqvtfskRrng+lKKA+ELSvLCda++a+iifs +gklye+++
  GSMUA_Achr2P11820_001 10 RLENATSRQVTFSKRRNGLLKKAFELSVLCDADIALIIFSARGKLYEFAT 59
                           679*********************************************86 PP

2K-box25.84.6e-1078128656
                  K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeq 56 
                            + s+ e++ + ++ e+a++ k++e L++++ ++lGe+Les sl+eL++Le 
  GSMUA_Achr2P11820_001  78 SGSVIEHDKQPCRYEAANMVKKMEHLESSIWKILGEKLESYSLEELHELEG 128
                            334778889999*************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.062161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-38160IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-30323IPR002100Transcription factor, MADS-box
CDDcd002651.25E-40370No hitNo description
SuperFamilySSF554551.26E-31383IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.4E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.0E-884128IPR002487Transcription factor, K-box
PROSITE profilePS512976.63686139IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MVRGKTQLRR LENATSRQVT FSKRRNGLLK KAFELSVLCD ADIALIIFSA RGKLYEFATS  60
SMQEILDRYR GQAKERTSGS VIEHDKQPCR YEAANMVKKM EHLESSIWKI LGEKLESYSL  120
EELHELEGKS PGNLLSTSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-20383285Myocyte-specific enhancer factor 2A
3p57_I2e-20383285Myocyte-specific enhancer factor 2A
3p57_D2e-20383285Myocyte-specific enhancer factor 2A
3p57_C2e-20383285Myocyte-specific enhancer factor 2A
3p57_B2e-20383285Myocyte-specific enhancer factor 2A
3p57_A2e-20383285Myocyte-specific enhancer factor 2A
3kov_J2e-20383285Myocyte-specific enhancer factor 2A
3kov_I2e-20383285Myocyte-specific enhancer factor 2A
3kov_B2e-20383285Myocyte-specific enhancer factor 2A
3kov_A2e-20383285Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389124.18e-74PREDICTED: MADS-box protein SOC1-like
SwissprotO646452e-53SOC1_ARATH; MADS-box protein SOC1
TrEMBLM0S7733e-99M0S773_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P11820_0017e-99(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-48AGAMOUS-like 20